PDB entry 2uxq

View 2uxq on RCSB PDB site
Description: isocitrate dehydrogenase from the psychrophilic bacterium desulfotalea psychrophila: biochemical properties and crystal structure analysis
Class: oxidoreductase
Keywords: psychrophilic, cold adaptation, thermal stability, isocitrate dehydrogenase, oxidoreductase
Deposited on 2007-03-29, released 2008-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.146
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase native
    Species: DESULFOTALEA PSYCHROPHILA [TaxId:84980]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uxqa_
  • Chain 'B':
    Compound: isocitrate dehydrogenase native
    Species: DESULFOTALEA PSYCHROPHILA [TaxId:84980]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uxqb_
  • Chain 'C':
    Compound: isocitrate dehydrogenase native
    Species: DESULFOTALEA PSYCHROPHILA [TaxId:84980]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uxqc_
  • Chain 'D':
    Compound: isocitrate dehydrogenase native
    Species: DESULFOTALEA PSYCHROPHILA [TaxId:84980]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uxqd_
  • Heterogens: GOL, SO4, MG, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uxqA (A:)
    mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
    eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
    rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
    ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
    ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
    yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
    eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2uxqB (B:)
    mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
    eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
    rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
    ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
    ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
    yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
    eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uxqB (B:)
    mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
    eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
    rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
    ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
    ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
    yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
    eciesgymtgdlaricepaaikvldsiefidelgkrlqqln
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uxqC (C:)
    mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
    eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
    rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
    ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
    ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
    yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
    eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uxqD (D:)
    mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
    eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
    rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
    ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
    ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
    yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
    eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk