PDB entry 2uxg

View 2uxg on RCSB PDB site
Description: pseudoazurin with engineered amicyanin ligand loop, reduced form, ph 5.5
Class: electron transport
Keywords: type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport, spectroscopic properties, loop shortening, protein scaffold, electron transfer
Deposited on 2007-03-28, released 2007-08-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.163
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pseudoazurin
  Species: Achromobacter cycloclastes [TaxId:223]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19567 (83-121)
  • PDB 2UXG (81-82)
  Domains in SCOPe 2.04: d2uxga_
• Heterogens: CU, GOL, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uxgA (A:)
  adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
  nenykvtftapgvygvkctphpfmvgvvqvgdapanleavkgaknpkkaqerldaalaal
  gn