PDB entry 2uxf

View 2uxf on RCSB PDB site
Description: Pseudoazurin with engineered amicyanin ligand loop, oxidized form, pH 5.5
Class: electron transport
Keywords: type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport, spectroscopic properties, loop shortening, protein scaffold, electron transfer
Deposited on 2007-03-28, released 2007-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pseudoazurin
  Species: Achromobacter cycloclastes [TaxId:223]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19567 (83-121)
  • PDB 2UXF (81-82)
  Domains in SCOPe 2.08: d2uxfa_
• Heterogens: CU, GOL, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uxfA (A:)
  adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
  nenykvtftapgvygvkctphpfmvgvvqvgdapanleavkgaknpkkaqerldaalaal
  gn