PDB entry 2ux2

View 2ux2 on RCSB PDB site
Description: high resolution structure of human cd59
Class: immune system
Keywords: mac, mirl, cd59, membrane, gpi-anchor, lipoprotein, glycoprotein, complement regulator, immune system
Deposited on 2007-03-26, released 2007-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cd59 glycoprotein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2UX2 (0-0)
  • Uniprot P13987 (1-77)
  Domains in SCOPe 2.08: d2ux2a2, d2ux2a3
• Chain 'B':
  Compound: cd59 glycoprotein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2UX2 (0-0)
  • Uniprot P13987 (1-77)
  Domains in SCOPe 2.08: d2ux2b2, d2ux2b3
• Chain 'C':
  Compound: cd59 glycoprotein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2UX2 (0-0)
  • Uniprot P13987 (1-77)
  Domains in SCOPe 2.08: d2ux2c2, d2ux2c3
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ux2A (A:)
  mlqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
  tyycckkdlcnfneqlen
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ux2B (B:)
  mlqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
  tyycckkdlcnfneqlen
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ux2C (C:)
  mlqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
  tyycckkdlcnfneqlen