PDB entry 2uwr

View 2uwr on RCSB PDB site
Description: high resolution structure of human cd59
Class: membrane protein
Keywords: mac, mirl, cd59, membrane, gpi-anchor, lipoprotein, glycoprotein, complement regulator, membrane protein
Deposited on 2007-03-23, released 2007-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.207
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd59 glycoprotein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UWR (78-78)
    • Uniprot P13987 (1-77)
    Domains in SCOPe 2.08: d2uwra2, d2uwra3, d2uwra4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uwrA (A:)
    mlqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
    tyycckkdlcnfneqlenc