PDB entry 2uwq

View 2uwq on RCSB PDB site
Description: solution structure of aspp2 n-terminus
Deposited on 2007-03-22, released 2007-07-10
The last revision was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptosis-stimulating of p53 protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UWQ (0-2)
    • Uniprot Q13625 (3-85)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2uwqA (A:)
ggsmmpmfltvylsnneqhftevpvtpeticrdvvdlckepgesdchlaevwcgserpva
dnermfdvlqrfgsqrnevrfflrhe