PDB entry 2uwc

View 2uwc on RCSB PDB site
Description: crystal structure of nasturtium xyloglucan hydrolase isoform nxg2
Class: hydrolase
Keywords: tropaeolum majus, xyloglucan hydrolase, xyloglucan-endo-transferase, hydrolase, glycosidase, family gh16, isoform nxg2
Deposited on 2007-03-20, released 2007-06-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.168
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: TROPAEOLUM MAJUS [TaxId:4020]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07524 (Start-270)
      • conflict (128)
      • conflict (177)
    Domains in SCOPe 2.05: d2uwca_
  • Chain 'B':
    Compound: cellulase
    Species: TROPAEOLUM MAJUS [TaxId:4020]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07524 (Start-270)
      • conflict (128)
      • conflict (177)
    Domains in SCOPe 2.05: d2uwcb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uwcA (A:)
    qgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrsg
    yfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegsg
    dyniigrelrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrpmwv
    ygsvwdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqq
    qvaamewvqknymvynycddptrdhtltpec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uwcA (A:)
    ppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrsgyf
    ganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegsgdy
    niigrelrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrpmwvyg
    svwdasswatkykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqqqvaam
    ewvqknymvynycddptrdhtltpec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2uwcB (B:)
    qgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrsg
    yfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegsg
    dyniigrelrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrpmwv
    ygsvwdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqq
    qvaamewvqknymvynycddptrdhtltpec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uwcB (B:)
    ppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrsgyf
    ganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegsgdy
    niigrelrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrpmwvyg
    svwdasswatykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqqqvaame
    wvqknymvynycddptrdhtltpec