PDB entry 2uwb

View 2uwb on RCSB PDB site
Description: crystal structure of the nasturtium seedling mutant xyloglucanase isoform nxg1-delta-yniig
Class: hydrolase
Keywords: xyloglucan-endo-transferase, glycoside hydrolase, loop mutant nxg1- yniig, hydrolase, glycosidase, family gh16, tropaeolum majus xyloglucanase
Deposited on 2007-03-20, released 2007-06-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: TROPAEOLUM MAJUS [TaxId:4020]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UWB (0-0)
    • Uniprot Q07524 (122-266)
    Domains in SCOPe 2.05: d2uwba_
  • Chain 'B':
    Compound: cellulase
    Species: TROPAEOLUM MAJUS [TaxId:4020]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UWB (0-0)
    • Uniprot Q07524 (122-266)
    Domains in SCOPe 2.05: d2uwbb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uwbA (A:)
    vqgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrs
    gyfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegs
    gdremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrplwvygsv
    wdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqqqvaa
    mewvqknymvynycddptrdhtltpec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uwbB (B:)
    vqgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrs
    gyfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegs
    gdremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrplwvygsv
    wdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqqqvaa
    mewvqknymvynycddptrdhtltpec