PDB entry 2uvs

View 2uvs on RCSB PDB site
Description: High Resolution Solid-state NMR structure of Kaliotoxin
Class: toxin
Keywords: toxin, ionic channel inhibitor, potassium channel inhibitor, amidation, neurotoxin
Deposited on 2007-03-14, released 2008-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: SOLID-STATENMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: potassium channel toxin alpha-ktx 3.1
  Species: ANDROCTONUS MAURETANICUS [TaxId:6859]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24662 (0-37)
  Domains in SCOPe 2.08: d2uvsa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uvsA (A:)
  gveinvkcsgspqclkpckdagmrfgkcmnrkchctpk