PDB entry 2uvr

View 2uvr on RCSB PDB site
Description: crystal structures of mutant dpo4 DNA polymerases with 8-oxog containing DNA template-primer constructs
Class: transferase
Keywords: transferase, DNA-directed DNA polymerase, p2 DNA polymerase IV, nucleotidyltransferase, 7, magnesium, DNA damage, DNA repair, DNA-binding, translesion DNA polymerase, metal-binding, 8-dihydro-8- oxodeoxyguanosine, metal- binding, mutator protein, DNA replication
Deposited on 2007-03-13, released 2007-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.232
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UVR (6-23)
      • engineered mutation (337)
    • Uniprot Q97W02 (6-End)
    Domains in SCOPe 2.07: d2uvra1, d2uvra2
  • Chain 'P':
    Compound: 5'-d(*gp*gp*gp*gp*gp*ap*ap*gp*gp*ap *tp*tp*cp*c)-3'
  • Chain 'T':
    Compound: 5'-d(*tp*cp*ap*cp*8ogp*gp*ap*ap*tp*cp *cp*tp*tp*cp*cp*cp*cp*c)-3'
  • Heterogens: DGT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uvrA (A:)
    hhhhhhmivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfg
    vkagipiveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdk
    vrdyreaynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrl
    ireldiadvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeyn
    epirtrvrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedld
    ivsrgrtfphgisketaysesvkllqkileederkiraigvrfskfieaigldkffdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uvrA (A:)
    mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkiraigvrfskfie
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.