PDB entry 2uvd

View 2uvd on RCSB PDB site
Description: The crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from Bacillus anthracis (BA3989)
Class: oxidoreductase
Keywords: 3-oxoacyl-(acyl carrier protein) reductase, beta-ketoacyl-(acyl carrier protein) reductase, short-chain dehydrogenase/reductase (sdr), oxford protein production facility, nadp, fabg, oppf, oxidoreductase, lipid synthesis, structural proteomics in europe (spine), structural genomics, fatty acid biosynthesis
Deposited on 2007-03-09, released 2007-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uvda_
  • Chain 'B':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uvdb_
  • Chain 'C':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uvdc_
  • Chain 'D':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uvdd_
  • Chain 'E':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uvde_
  • Chain 'F':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uvdf_
  • Chain 'G':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uvdg_
  • Chain 'H':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uvdh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uvdA (A:)
    mlkgkvalvtgasrgigraiaidlakqganvvvnyagneqkanevvdeikklgsdaiavr
    advanaedvtnmvkqtvdvfgqvdilvnnagvtkdnllmrmkeeewdtvintnlkgvflc
    tkavsrfmmrqrhgrivniasvvgvtgnpgqanyvaakagvigltktsakelasrnitvn
    aiapgfiatdmtdvldenikaemlklipaaqfgeaqdianavtffasdqskyitgqtlnv
    dggmvm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uvdB (B:)
    mlkgkvalvtgasrgigraiaidlakqganvvvnyagneqkanevvdeikklgsdaiavr
    advanaedvtnmvkqtvdvfgqvdilvnnagvtkdnllmrmkeeewdtvintnlkgvflc
    tkavsrfmmrqrhgrivniasvvgvtgnpgqanyvaakagvigltktsakelasrnitvn
    aiapgfiatdmtdvldenikaemlklipaaqfgeaqdianavtffasdqskyitgqtlnv
    dggmvm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uvdC (C:)
    mlkgkvalvtgasrgigraiaidlakqganvvvnyagneqkanevvdeikklgsdaiavr
    advanaedvtnmvkqtvdvfgqvdilvnnagvtkdnllmrmkeeewdtvintnlkgvflc
    tkavsrfmmrqrhgrivniasvvgvtgnpgqanyvaakagvigltktsakelasrnitvn
    aiapgfiatdmtdvldenikaemlklipaaqfgeaqdianavtffasdqskyitgqtlnv
    dggmvm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uvdD (D:)
    mlkgkvalvtgasrgigraiaidlakqganvvvnyagneqkanevvdeikklgsdaiavr
    advanaedvtnmvkqtvdvfgqvdilvnnagvtkdnllmrmkeeewdtvintnlkgvflc
    tkavsrfmmrqrhgrivniasvvgvtgnpgqanyvaakagvigltktsakelasrnitvn
    aiapgfiatdmtdvldenikaemlklipaaqfgeaqdianavtffasdqskyitgqtlnv
    dggmvm
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uvdE (E:)
    mlkgkvalvtgasrgigraiaidlakqganvvvnyagneqkanevvdeikklgsdaiavr
    advanaedvtnmvkqtvdvfgqvdilvnnagvtkdnllmrmkeeewdtvintnlkgvflc
    tkavsrfmmrqrhgrivniasvvgvtgnpgqanyvaakagvigltktsakelasrnitvn
    aiapgfiatdmtdvldenikaemlklipaaqfgeaqdianavtffasdqskyitgqtlnv
    dggmvm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uvdF (F:)
    mlkgkvalvtgasrgigraiaidlakqganvvvnyagneqkanevvdeikklgsdaiavr
    advanaedvtnmvkqtvdvfgqvdilvnnagvtkdnllmrmkeeewdtvintnlkgvflc
    tkavsrfmmrqrhgrivniasvvgvtgnpgqanyvaakagvigltktsakelasrnitvn
    aiapgfiatdmtdvldenikaemlklipaaqfgeaqdianavtffasdqskyitgqtlnv
    dggmvm
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uvdG (G:)
    mlkgkvalvtgasrgigraiaidlakqganvvvnyagneqkanevvdeikklgsdaiavr
    advanaedvtnmvkqtvdvfgqvdilvnnagvtkdnllmrmkeeewdtvintnlkgvflc
    tkavsrfmmrqrhgrivniasvvgvtgnpgqanyvaakagvigltktsakelasrnitvn
    aiapgfiatdmtdvldenikaemlklipaaqfgeaqdianavtffasdqskyitgqtlnv
    dggmvm
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uvdH (H:)
    mlkgkvalvtgasrgigraiaidlakqganvvvnyagneqkanevvdeikklgsdaiavr
    advanaedvtnmvkqtvdvfgqvdilvnnagvtkdnllmrmkeeewdtvintnlkgvflc
    tkavsrfmmrqrhgrivniasvvgvtgnpgqanyvaakagvigltktsakelasrnitvn
    aiapgfiatdmtdvldenikaemlklipaaqfgeaqdianavtffasdqskyitgqtlnv
    dggmvm