PDB entry 2uv6

View 2uv6 on RCSB PDB site
Description: crystal structure of a cbs domain pair from the regulatory gamma1 subunit of human ampk in complex with amp
Class: transferase
Keywords: transferase, cbs domain, lipid synthesis, fatty acid biosynthesis, ampk gamma1 subunit cbs 3 plus 4 amp regulatory subunit. r transferase
Deposited on 2007-03-09, released 2007-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UV6 (Start-7)
      • engineered mutation (125)
    • Uniprot P54619 (8-End)
    Domains in SCOPe 2.08: d2uv6a1, d2uv6a2
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2uv6A (A:)
mahhhhhhefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvde
kgrvvdiyskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlv
eaevhqlvvvdendvvkgivslsdilqalvlt

    Sequence, based on observed residues (ATOM records): (download) 
    >2uv6A (A:)
hefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdi
yskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhql
vvvdendvvkgivslsdilqalvl