PDB entry 2uv4

View 2uv4 on RCSB PDB site
Description: crystal structure of a cbs domain pair from the regulatory gamma1 subunit of human ampk in complex with amp
Class: transferase
Keywords: transferase, cbs domain, lipid synthesis, fatty acid biosynthesis, ampk gamma1 subunit cbs 3 plus 4 amp regulatory subunit
Deposited on 2007-03-09, released 2007-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.171
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UV4 (Start-7)
    • Uniprot P54619 (8-End)
    Domains in SCOPe 2.08: d2uv4a1, d2uv4a2
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2uv4A (A:)
mahhhhhhefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvde
kgrvvdiyskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlv
eaevhrlvvvdendvvkgivslsdilqalvlt

    Sequence, based on observed residues (ATOM records): (download) 
    >2uv4A (A:)
hefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdi
yskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrl
vvvdendvvkgivslsdilqalvl