PDB entry 2uv3

View 2uv3 on RCSB PDB site
Description: structure of the signal-regulatory protein (sirp) alpha domain that binds cd47.
Class: receptor
Keywords: cd47-binding domain of sirp-alpha, receptor, membrane, sh3- binding, glycoprotein, transmembrane, phosphorylation, human sirp-alpha n terminal v domain, immunoglobulin domain, signal-regulatory protein alpha
Deposited on 2007-03-08, released 2007-03-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78324 (Start-117)
    • PDB 2UV3 (118-End)
    Domains in SCOPe 2.04: d2uv3a_
  • Chain 'B':
    Compound: tyrosine-protein phosphatase non-receptor type substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78324 (Start-117)
    • PDB 2UV3 (118-End)
    Domains in SCOPe 2.04: d2uv3b_
  • Heterogens: MES, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uv3A (A:)
    eeelqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprv
    ttvsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvrakpstr
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uv3A (A:)
    eelqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprvt
    tvsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvrakpstrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2uv3B (B:)
    eeelqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprv
    ttvsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvrakpstr
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uv3B (B:)
    eelqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprvt
    tvsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvrakpstrh
    hh