PDB entry 2uv2

View 2uv2 on RCSB PDB site
Description: crystal structure of human ste20-like kinase bound to 4-(4-(5-cyclopropyl-1h-pyrazol-3-ylamino)-quinazolin-2-ylamino)-phenyl)-acetonitrile
Class: transferase
Keywords: transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, muscle development, kinase, apoptosis, germinal centre kinase, serine- threonine kinase 2, nucleotide-binding, serine-threonine-protein kinase
Deposited on 2007-03-08, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ste20-like serine-threonine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2UV2
      • engineered mutation (29)
      • microheterogeneity (187)
    • Uniprot Q9H2G2
    Domains in SCOPe 2.07: d2uv2a1
  • Heterogens: EDO, SCN, GVD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uv2A (A:)
    mhhhhhhssgvdlgtenlyfqsmkqyehvtrdlnpedfweiigelgdgafgkvykaqnke
    tsvlaaakvidtkseeeledymveidilascdhpnivklldafyyennlwiliefcagga
    vdavmlelerpltesqiqvvckqtldalnylhdnkiihrdlkagnilftldgdikladfg
    vsakntrtiqrrdsfigtpywmapevvmcetskdrpydykadvwslgitliemaeiepph
    helnpmrvllkiaksepptlaqpsrwssnfkdflkkcleknvdarwttsqllqhpfvtvd
    snkpireliaeakaevteevedgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uv2A (A:)
    yehvtrdlnpedfweiigelgdfgkvykaqnketsvlaaakvidtkseeeledymveidi
    lascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtlda
    lnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmapevv
    mcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsrws
    snfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak