PDB entry 2uuy

View 2uuy on RCSB PDB site
Description: structure of a tick tryptase inhibitor in complex with bovine trypsin
Class: hydrolase
Keywords: calcium, zymogen, protease, hydrolase, digestion, metal-binding, serine protease, tryptase inhibitor
Deposited on 2007-03-08, released 2007-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.132
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2uuya_
  • Chain 'B':
    Compound: tryptase inhibitor
    Species: RHIPICEPHALUS APPENDICULATUS [TaxId:34631]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1EG59 (0-51)
      • conflict (51)
    Domains in SCOPe 2.06: d2uuyb1
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uuyA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uuyB (B:)
    ctvpigwsepvkglckarftryycmgncckvyegcytggysrmgecarncpa