PDB entry 2uux

View 2uux on RCSB PDB site
Description: structure of the tryptase inhibitor tdpi from a tick
Class: inhibitor
Keywords: inhibitor, tryptase inhibitor
Deposited on 2007-03-08, released 2007-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.171
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptase inhibitor
    Species: RHIPICEPHALUS APPENDICULATUS [TaxId:34631]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUX (0-1)
    • Uniprot Q1EG59 (2-54)
    Domains in SCOPe 2.08: d2uuxa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uuxA (A:)
    aaectvpigwsepvkglckarftryycmgncckvyegcytggysrmgecarncpg