PDB entry 2uum

View 2uum on RCSB PDB site
Description: crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers.
Class: electron transport
Keywords: photosynthesis, electron transport, spirulina sp, c-phycocyanin, phycobilisome, marine, transport, lyngbya sp, phormidium, chromophore, fresh water, methylation, bile pigment
Deposited on 2007-03-04, released 2008-05-27
The last revision prior to the SCOP 1.75 freeze date was dated 2008-05-27, with a file datestamp of 2008-05-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.203
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uuma1
• Chain 'B':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72508 (0-171)
    • conflict (39)
    • conflict (76)
    • conflict (131)
• Chain 'C':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uumc1
• Chain 'D':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72508 (0-171)
    • conflict (39)
    • conflict (76)
    • conflict (131)
• Chain 'E':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uume1
• Chain 'F':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72508 (0-171)
    • conflict (39)
    • conflict (76)
    • conflict (131)
• Chain 'G':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uumg1
• Chain 'H':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72508 (0-171)
    • conflict (39)
    • conflict (76)
    • conflict (131)
• Chain 'I':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uumi1
• Chain 'J':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72508 (0-171)
    • conflict (39)
    • conflict (76)
    • conflict (131)
• Chain 'K':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uumk1
• Chain 'L':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72508 (0-171)
    • conflict (39)
    • conflict (76)
    • conflict (131)
• Chain 'M':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uumm1
• Chain 'N':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72508 (0-171)
    • conflict (39)
    • conflict (76)
    • conflict (131)
• Chain 'O':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uumo1
• Chain 'P':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72508 (0-171)
    • conflict (39)
    • conflict (76)
    • conflict (131)
• Chain 'Q':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uumq1
• Chain 'R':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72508 (0-171)
    • conflict (39)
    • conflict (76)
    • conflict (131)
• Chain 'S':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uums1
• Chain 'T':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72508 (0-171)
    • conflict (39)
    • conflict (76)
    • conflict (131)
• Chain 'U':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uumu1
• Chain 'V':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72508 (0-171)
    • conflict (39)
    • conflict (76)
    • conflict (131)
• Chain 'W':
  Compound: C-phycocyanin alpha chain
  Species: SPIRULINA SP.
  Database cross-references and differences (RAF-indexed):
  • Uniprot P72509 (0-161)
    • conflict (10)
    • conflict (147)
  Domains in SCOP 1.75: d2uumw1
• Chain 'X':
  Compound: C-phycocyanin beta chain
  Species: SPIRULINA SP.
  
• Heterogens: CYC, BLA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumA (A:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumC (C:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumE (E:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumG (G:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumI (I:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumK (K:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumM (M:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumO (O:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumQ (Q:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumS (S:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'U':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumU (U:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'V':
  No sequence available.
  
  
• Chain 'W':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uumW (W:)
  mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
  nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
  tfelspswyiealkyikanhglsgdaaveansyldyainals
  

  
  
• Chain 'X':
  No sequence available.