PDB entry 2uul

View 2uul on RCSB PDB site
Description: crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers.
Class: electron transport
Keywords: electron transport, c-phycocyanin, phycobilisome, photosynthesis, chromophore, fresh water, methylation, bile pigment, marine, lyngbya, spirulina, transport, phormidium
Deposited on 2007-03-04, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.202
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUL (0-End)
    Domains in SCOPe 2.07: d2uula_
  • Chain 'B':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uulb_
  • Chain 'C':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uulc_
  • Chain 'D':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uuld_
  • Chain 'E':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUL (0-End)
    Domains in SCOPe 2.07: d2uule_
  • Chain 'F':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uulf_
  • Chain 'G':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUL (0-End)
    Domains in SCOPe 2.07: d2uulg_
  • Chain 'H':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uulh_
  • Chain 'I':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUL (0-End)
    Domains in SCOPe 2.07: d2uuli_
  • Chain 'J':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uulj_
  • Chain 'K':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUL (0-End)
    Domains in SCOPe 2.07: d2uulk_
  • Chain 'L':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uull_
  • Chain 'M':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUL (0-End)
    Domains in SCOPe 2.07: d2uulm_
  • Chain 'N':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uuln_
  • Chain 'O':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUL (0-End)
    Domains in SCOPe 2.07: d2uulo_
  • Chain 'P':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uulp_
  • Chain 'Q':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUL (0-End)
    Domains in SCOPe 2.07: d2uulq_
  • Chain 'R':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uulr_
  • Chain 'S':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUL (0-End)
    Domains in SCOPe 2.07: d2uuls_
  • Chain 'T':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uult_
  • Chain 'U':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUL (0-End)
    Domains in SCOPe 2.07: d2uulu_
  • Chain 'V':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uulv_
  • Chain 'W':
    Compound: C-phycocyanin alpha chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUL (0-End)
    Domains in SCOPe 2.07: d2uulw_
  • Chain 'X':
    Compound: C-phycocyanin beta chain
    Species: PHORMIDIUM SP. [TaxId:1199]
    Domains in SCOPe 2.07: d2uulx_
  • Heterogens: CYC, BLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulA (A:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglagdaaaeansyldyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulB (B:)
    mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
    aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulC (C:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglsgdaaveansyldyainals
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulD (D:)
    mfdaftkvvsqadtrgemvsvaqidalsqmvaeankrldvvnritsnastvvsnaarslf
    aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasvledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulE (E:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglagdaaaeansyldyainals
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulF (F:)
    mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
    aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulG (G:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglagdaaaeansyldyainals
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulH (H:)
    mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
    aeqpqliapggnadtsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulI (I:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglagdaaaeansyldyainals
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulJ (J:)
    mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
    aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulK (K:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglagdaaaeansyldyainals
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulL (L:)
    mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
    aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulM (M:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglagdaaaeansyldyainals
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulN (N:)
    mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
    aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulO (O:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglagdaaaeansyldyainals
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulP (P:)
    mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
    aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulQ (Q:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglagdaaaeansyldyainals
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulR (R:)
    mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
    aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulS (S:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglagdaaaeansyldyainals
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulT (T:)
    mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
    aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulU (U:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglagdaaaeansyldyainals
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulV (V:)
    mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
    aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulW (W:)
    mktpltdavstadsqgrflssteiqvafgrfrqakaglaaanaltsaadalisgaaqavy
    nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
    tfelspswyiealkyikanhglagdaaaeansyldyainals
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uulX (X:)
    mfdaftkvaaqadtrgemvsvaqidalsqmvaeankrldavnritanastvvsnaaralf
    aeqpqliapggnaytsnrmaaclrdmeiilryvtyavfagdasaledrclnglretysal
    gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs