PDB entry 2uuh

View 2uuh on RCSB PDB site
Description: crystal structure of human leukotriene c4 synthase in complex with substrate glutathione
Class: lyase
Keywords: membrane protein, leukotriene signalling, lyase, mapeg, human, ltc4s, enzyme, trimer, membrane, leukotriene biosynthesis, eicosanoid, glutathione, transmembrane
Deposited on 2007-03-02, released 2007-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leukotriene c4 synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUH (Start-6)
    • Uniprot Q16873 (7-End)
    Domains in SCOPe 2.08: d2uuha1, d2uuha2
  • Heterogens: NI, LMU, GSH, PAM, PLM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2uuhA (A:)
mhhhhhhkdevallaavtllgvllqayfslqvisarrafrvspplttgppefervyraqv
ncseyfplflatlwvagiffhegaaalcglvylfarlryfqgyarsaqlrlaplyasara
lwllvalaalgllahflpaalraallgrlrtllpwa

    Sequence, based on observed residues (ATOM records): (download) 
    >2uuhA (A:)
hhhhhhkdevallaavtllgvllqayfslqvisarrafrvspplttgppefervyraqvn
cseyfplflatlwvagiffhegaaalcglvylfarlryfqgyarsaqlrlaplyasaral
wllvalaalgllahflpaalraallgrlrtl