PDB entry 2uug

View 2uug on RCSB PDB site
Description:
Deposited on 1998-10-31, released 1999-03-25
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-25, with a file datestamp of 1999-03-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.178
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2uuga_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2uugb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2uugc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2uugd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uugA (A:)
    ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
    pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
    vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
    apdpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uugB (B:)
    ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
    pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
    vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
    apdpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uugC (C:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uugD (D:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml