PDB entry 2uug

View 2uug on RCSB PDB site
Description: escherichia coli uracil-DNA glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi
Class: replication, hydrolase
Keywords: DNA base excision repair, protein mimicry of DNA, protein inhibitor, replication, hydrolase
Deposited on 1998-10-31, released 1999-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.178
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Escherichia coli [TaxId:83333]
    Gene: UNG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12295
      • engineered (186)
    Domains in SCOPe 2.07: d2uuga_
  • Chain 'B':
    Compound: uracil-DNA glycosylase
    Species: Escherichia coli [TaxId:83333]
    Gene: UNG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12295
      • engineered (186)
    Domains in SCOPe 2.07: d2uugb_
  • Chain 'C':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene: UGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uugc_
  • Chain 'D':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene: UGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2uugd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uugA (A:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkapdpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaese
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uugA (A:)
    ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
    pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
    vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
    apdpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2uugB (B:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkapdpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaese
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uugB (B:)
    ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
    pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
    vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
    apdpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2uugC (C:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uugC (C:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2uugD (D:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uugD (D:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml