PDB entry 2uud
View 2uud on RCSB PDB site
Description: crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq10-1.12 scfv in complex with the hapten
Class: immune system
Keywords: scfv, antibody, immunoglobulin, 2-phenyl-5-oxazolone, immunoglobulin domain, immune system
Deposited on
2007-03-02, released
2007-04-03
The last revision prior to the SCOP 1.75 freeze date was dated
2007-04-03, with a file datestamp of
2007-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.228
AEROSPACI score: 0.2
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: nq10-1.12 anti-phox antibody
Species: Mus musculus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d2uudh1 - Chain 'J':
Compound: nq10-1.12 anti-phox antibody
Species: Mus musculus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d2uudj1 - Chain 'K':
Compound: nq10-1.12 anti-phox antibody
Species: Mus musculus
- Chain 'L':
Compound: nq10-1.12 anti-phox antibody
Species: Mus musculus
- Chain 'S':
Compound: nq10-1.12 anti-phox antibody
Species: Mus musculus
- Chain 'T':
Compound: nq10-1.12 anti-phox antibody
Species: Mus musculus
- Heterogens: PHX, HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>2uudH (H:)
evklvesggglvqpggslrlscatsgfsftdyymawvrqppgkalewlafirnkangytt
dysasvkgrftisrdnsqsilylqmntlraedsatyycargdyygawfaywgqgtlvtvs
a
- Chain 'J':
Sequence; same for both SEQRES and ATOM records: (download)
>2uudJ (J:)
evklvesggglvqpggslrlscatsgfsftdyymawvrqppgkalewlafirnkangytt
dysasvkgrftisrdnsqsilylqmntlraedsatyycargdyygawfaywgqgtlvtvs
a
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.
- Chain 'S':
No sequence available.
- Chain 'T':
No sequence available.