PDB entry 2utg

View 2utg on RCSB PDB site
Description: structure and refinement of the oxidized p21 form of uteroglobin at 1.64 angstroms resolution
Class: steroid binding
Keywords: steroid binding
Deposited on 1989-05-17, released 1989-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: uteroglobin
  Species: Oryctolagus cuniculus [TaxId:9986]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02779 (0-69)
  Domains in SCOPe 2.08: d2utga_
• Chain 'B':
  Compound: uteroglobin
  Species: Oryctolagus cuniculus [TaxId:9986]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02779 (0-69)
  Domains in SCOPe 2.08: d2utgb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2utgA (A:)
  gicprfahvienlllgtpssyetslkefepddtmkdagmqmkkvldslpqttrenimklt
  ekivksplcm
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2utgB (B:)
  gicprfahvienlllgtpssyetslkefepddtmkdagmqmkkvldslpqttrenimklt
  ekivksplcm