PDB entry 2ucz

View 2ucz on RCSB PDB site
Description: ubiquitin conjugating enzyme (ubc7) from saccharomyces cerevisiae
Class: ubiquitin conjugation
Keywords: ubiquitin conjugation, ligase, yeast
Deposited on 1997-11-07, released 1998-03-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.93 Å
R-factor: 0.227
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin conjugating enzyme
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: UBC7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ucza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uczA (A:)
    msktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklef
    pkdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsvekil
    lsvmsmlsepniesganidacilwrdnrpeferqvklsilkslgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uczA (A:)
    sktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklefp
    kdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsvekill
    svmsmlsepniesganidacilwrdnrpeferqvklsilkslgf