PDB entry 2uce

View 2uce on RCSB PDB site
Description: tertiary structures of class i ubiquitin conjugating enzymes are highly conserved: crystal structure of yeast ubc4
Deposited on 1993-10-14, released 1994-01-31
The last revision was dated 1999-05-24, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.198
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >2uce_ (-)
mssskriakelsdlerdpptscsagpvgddlyhwqasimgpadspyaggvfflsihfptd
ypfkppkisfttkiyhpninangnicldilkdqwspaltlskvllsicslltdanpddpl
vpeiahiyktdrpkyeatarewtkkyav

  • Chain 'p':
    No sequence available.