PDB entry 2ubp

View 2ubp on RCSB PDB site
Description: structure of native urease from bacillus pasteurii
Class: hydrolase
Keywords: urease, bacillus pasteurii, nickel, hydrolase
Deposited on 1998-11-04, released 1999-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.16
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (urease gamma subunit)
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ubpa_
  • Chain 'B':
    Compound: protein (urease beta subunit)
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ubpb_
  • Chain 'C':
    Compound: protein (urease alpha subunit)
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41020 (0-569)
      • variant (18)
      • insertion (27)
      • variant (28)
      • variant (35-37)
      • modified residue (219)
      • variant (262)
      • conflict (419)
    Domains in SCOPe 2.06: d2ubpc1, d2ubpc2
  • Heterogens: SO4, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ubpA (A:)
    mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
    khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ubpB (B:)
    nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
    rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
    ve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ubpC (C:)
    mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
    trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
    viaaegkivtaggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwni
    ekmlksteglpinvgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvad
    eadvqvaihsdtlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpss
    tnptrpftvntidehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismm
    stdalamgragemvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgi
    ahevgsieegkfadlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmy
    gtvgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidin
    petyevkvdgevltcepvkelpmaqryflf