PDB entry 2ubp

View 2ubp on RCSB PDB site
Description: structure of native urease from bacillus pasteurii
Deposited on 1998-11-04, released 1999-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-08, with a file datestamp of 1999-11-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.16
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ubpA (A:)
    mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
    khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ubpB (B:)
    nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
    rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
    ve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ubpC (C:)
    mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
    trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
    viaaegkivtaggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwni
    ekmlksteglpinvgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvad
    eadvqvaihsdtlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpss
    tnptrpftvntidehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismm
    stdalamgragemvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgi
    ahevgsieegkfadlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmy
    gtvgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidin
    petyevkvdgevltcepvkelpmaqryflf