PDB entry 2u2f

View 2u2f on RCSB PDB site
Description: solution structure of the second RNA-binding domain of hu2af65
Class: RNA-binding protein
Keywords: SPLICING, U2 SNRNP, RBD, RNA-BINDING PROTEIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 1999-05-26, released 1999-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (splicing factor u2af 65 kd subunit)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26368 (0-84)
  Domains in SCOPe 2.08: d2u2fa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2u2fA (A:)
  ahklfigglpnylnddqvkelltsfgplkafnlvkdsatglskgyafceyvdinvtdqai
  aglngmqlgdkkllvqrasvgakna