PDB entry 2u1a

View 2u1a on RCSB PDB site
Description: rna binding domain 2 of human u1a protein, nmr, 20 structures
Deposited on 1997-03-26, released 1997-09-26
The last revision prior to the SCOP 1.69 freeze date was dated 1997-09-26, with a file datestamp of 1997-09-26.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d2u1a__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2u1a_ (-)
  mapaqplsenppnhilfltnlpeetnelmlsmlfnqfpgfkevrlvpgrhdiafvefdne
  vqagaardalqgfkitqnnamkisfakk