PDB entry 2u1a

View 2u1a on RCSB PDB site
Description: RNA binding domain 2 of human u1a protein, nmr, 20 structures
Class: nuclear protein
Keywords: RNA binding domain, nuclear protein
Deposited on 1997-03-26, released 1997-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Gene: PHA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012 (0-87)
    • engineered (1)
  Domains in SCOPe 2.08: d2u1aa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2u1aA (A:)
  mapaqplsenppnhilfltnlpeetnelmlsmlfnqfpgfkevrlvpgrhdiafvefdne
  vqagaardalqgfkitqnnamkisfakk