PDB entry 2tun

View 2tun on RCSB PDB site
Description: conformational changes in the (ala-84-val) mutant of tumor necrosis factor
Class: lymphokine
Keywords: lymphokine
Deposited on 1993-10-06, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.198
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (83)
      • conflict (142)
    Domains in SCOPe 2.05: d2tuna_
  • Chain 'B':
    Compound: tumor necrosis factor-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (83)
      • conflict (142)
    Domains in SCOPe 2.05: d2tunb_
  • Chain 'C':
    Compound: tumor necrosis factor-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (83)
      • conflict (142)
    Domains in SCOPe 2.05: d2tunc_
  • Chain 'D':
    Compound: tumor necrosis factor-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (83)
      • conflict (142)
    Domains in SCOPe 2.05: d2tund_
  • Chain 'E':
    Compound: tumor necrosis factor-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (83)
      • conflict (142)
    Domains in SCOPe 2.05: d2tune_
  • Chain 'F':
    Compound: tumor necrosis factor-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered mutation (83)
      • conflict (142)
    Domains in SCOPe 2.05: d2tunf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2tunA (A:)
    vrsssrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfkgqgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiyl
    ggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tunA (A:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2tunB (B:)
    vrsssrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfkgqgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiyl
    ggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tunB (B:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2tunC (C:)
    vrsssrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfkgqgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiyl
    ggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tunC (C:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2tunD (D:)
    vrsssrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfkgqgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiyl
    ggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tunD (D:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2tunE (E:)
    vrsssrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfkgqgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiyl
    ggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tunE (E:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2tunF (F:)
    vrsssrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfkgqgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiyl
    ggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tunF (F:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial