PDB entry 2tun

View 2tun on RCSB PDB site
Description: conformational changes in the (ala-84-val) mutant of tumor necrosis factor
Deposited on 1993-10-06, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3.1 Å
R-factor: 0.198
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2tuna_
  • Chain 'B':
    Domains in SCOP 1.55: d2tunb_
  • Chain 'C':
    Domains in SCOP 1.55: d2tunc_
  • Chain 'D':
    Domains in SCOP 1.55: d2tund_
  • Chain 'E':
    Domains in SCOP 1.55: d2tune_
  • Chain 'F':
    Domains in SCOP 1.55: d2tunf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tunA (A:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tunB (B:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tunC (C:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tunD (D:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tunE (E:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tunF (F:)
    tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
    qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
    ekgdrlsaeinrpdyllfaesgqvyfgiial