PDB entry 2trt

View 2trt on RCSB PDB site
Description: tetracycline repressor class d
Deposited on 1994-03-04, released 1996-06-20
The last revision prior to the SCOP 1.71 freeze date was dated 1996-06-20, with a file datestamp of 1996-06-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >2trt_ (-)
    arlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqivggdkliipfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2trt_ (-)
    arlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaalnlppllrealqimdsddgeqaflhgl
    eslirgfevqltallqiv