PDB entry 2trm

View 2trm on RCSB PDB site
Description: the three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1988-04-25, released 1988-07-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • conflict (83)
    Domains in SCOPe 2.08: d2trma_
  • Heterogens: CA, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2trmA (A:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan