PDB entry 2tps

View 2tps on RCSB PDB site
Description:
Deposited on 1999-03-09, released 1999-03-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-18, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.181
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2tpsa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2tpsb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tpsA (A:)
    hgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltge
    arikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgv
    sahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggi
    tidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tpsB (B:)
    hhgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltg
    earikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilg
    vsahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgigg
    itidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr