PDB entry 2tps

View 2tps on RCSB PDB site
Description: thiamin phosphate synthase
Class: thiamin biosynthesis
Keywords: thiamin biosynthesis, tim barrel
Deposited on 1999-03-09, released 1999-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.181
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (thiamin phosphate synthase)
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39594 (5-226)
      • see remark 999 (1-4)
    Domains in SCOPe 2.07: d2tpsa1, d2tpsa2
  • Chain 'B':
    Compound: protein (thiamin phosphate synthase)
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39594 (5-226)
      • see remark 999 (0-4)
    Domains in SCOPe 2.07: d2tpsb1, d2tpsb2
  • Heterogens: MG, TPS, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2tpsA (A:)
    hhgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltg
    earikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilg
    vsahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgigg
    itidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tpsA (A:)
    hgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltge
    arikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgv
    sahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggi
    tidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tpsB (B:)
    hhgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltg
    earikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilg
    vsahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgigg
    itidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr