PDB entry 2tpr

View 2tpr on RCSB PDB site
Description: x-ray structure of trypanothione reductase from crithidia fasciculata at 2.4 angstroms resolution
Deposited on 1991-08-22, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.18
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tprA (A:)
    sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
    lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
    fhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsnea
    fyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlteq
    lranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqlekagv
    evakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdhtk
    vacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnhad
    gevlgvhmlgdsspeiiqsvaiclkmgakisdvyntigvhptsaeelcsmrtpayfyekg
    kr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tprB (B:)
    sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
    lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
    fhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsnea
    fyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlteq
    lranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqlekagv
    evakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdhtk
    vacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnhad
    gevlgvhmlgdsspeiiqsvaiclkmgakisdvyntigvhptsaeelcsmrtpayfyekg
    kr