PDB entry 2tpl

View 2tpl on RCSB PDB site
Description: tyrosine phenol-lyase from citrobacter intermedius complex with 3-(4'-hydroxyphenyl)propionic acid, pyridoxal-5'-phosphate and cs+ ion
Class: lyase
Keywords: lyase, plp-dependent enzyme, pyridoxal phosphate
Deposited on 1997-01-23, released 1997-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31013 (Start-455)
      • modified residue (256)
    Domains in SCOPe 2.06: d2tpla_
  • Chain 'B':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31013 (Start-455)
      • modified residue (256)
    Domains in SCOPe 2.06: d2tplb_
  • Heterogens: CS, HPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2tplA (A:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlrfftarfdyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tplA (A:)
    nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
    agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
    yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
    vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
    hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
    maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
    paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
    dgiiklyqhkedirglkfiyepkqlrfftarfdyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2tplB (B:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlrfftarfdyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tplB (B:)
    nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
    agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
    yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
    vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
    hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
    maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
    paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
    dgiiklyqhkedirglkfiyepkqlrfftarfdyi