PDB entry 2tnf

View 2tnf on RCSB PDB site
Description: 1.4 a resolution structure of mouse tumor necrosis factor, towards modulation of its selectivity and trimerisation
Deposited on 1998-10-12, released 1999-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 1999-10-12, with a file datestamp of 1999-10-11.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.201
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d2tnfa_
  • Chain 'B':
    Domains in SCOP 1.71: d2tnfb_
  • Chain 'C':
    Domains in SCOP 1.71: d2tnfc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2tnfA (A:)
    lrsssqnssdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvys
    qvlfkgqgcpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylg
    gvfqlekgdqlsaevnlpkyldfaesgqvyfgvial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tnfA (A:)
    sdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvysqvlfkgqg
    cpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylggvfqlekg
    dqlsaevnlpkyldfaesgqvyfgvial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2tnfB (B:)
    lrsssqnssdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvys
    qvlfkgqgcpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylg
    gvfqlekgdqlsaevnlpkyldfaesgqvyfgvial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tnfB (B:)
    sdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvysqvlfkgqg
    cpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylggvfqlekg
    dqlsaevnlpkyldfaesgqvyfgvial
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2tnfC (C:)
    lrsssqnssdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvys
    qvlfkgqgcpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylg
    gvfqlekgdqlsaevnlpkyldfaesgqvyfgvial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tnfC (C:)
    sdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvysqvlfkgqg
    cpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylggvfqlekg
    dqlsaevnlpkyldfaesgqvyfgvial