PDB entry 2tnf

View 2tnf on RCSB PDB site
Description:
Deposited on 1998-10-12, released 1999-10-12
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-12, with a file datestamp of 1999-10-11.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.201
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2tnfa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2tnfb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2tnfc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tnfA (A:)
    sdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvysqvlfkgqg
    cpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylggvfqlekg
    dqlsaevnlpkyldfaesgqvyfgvial
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tnfB (B:)
    sdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvysqvlfkgqg
    cpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylggvfqlekg
    dqlsaevnlpkyldfaesgqvyfgvial
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tnfC (C:)
    sdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvysqvlfkgqg
    cpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylggvfqlekg
    dqlsaevnlpkyldfaesgqvyfgvial