PDB entry 2tmy

View 2tmy on RCSB PDB site
Description: chey from thermotoga maritima (apo-II)
Class: chemotaxis
Keywords: chemotaxis, phosphoryl transfer, signal transduction
Deposited on 1997-05-19, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.181
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chey protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: cheY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2tmya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2tmyA (A:)
mgkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpem
ngidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvsk

    Sequence, based on observed residues (ATOM records): (download) 
    >2tmyA (A:)
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs