PDB entry 2tmp

View 2tmp on RCSB PDB site
Description: n-terminal domain of tissue inhibitor of metalloproteinase-2 (n-timp-2), nmr, 49 structures
Class: metalloprotease inhibitor
Keywords: timp, metalloproteinase inhibitor, ob protein fold, metalloprotease inhibitor
Deposited on 1998-05-26, released 1998-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tissue inhibitor of metalloproteinases-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16035 (0-126)
      • conflict (20)
    Domains in SCOPe 2.08: d2tmpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tmpA (A:)
    cscspvhpqqafcnadvvirtkavsekevdsgndiygnpikriqyeikqikmfkgpekdi
    efiytapssavcgvsldvggkkeyliagkaegdgkmhitlcdfivpwdtlsttqkkslnh
    ryqmgce