PDB entry 2tmk

View 2tmk on RCSB PDB site
Description: yeast thymidylate kinase complexed with 3'-azido-3'-deoxythymidine monophosphate (azt-mp)
Class: phosphotransferase
Keywords: transferase (phosphotransferase), kinase, thymidine activation pathway, enzyme, azt
Deposited on 1997-06-12, released 1998-06-17
The last revision prior to the SCOP 1.75 freeze date was dated 1998-06-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.182
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Gene: CDC8
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2tmka_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Gene: CDC8
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2tmkb_
  • Heterogens: SO4, ATM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2tmkA (A:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmkA (A:)
    grgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqlsd
    qaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdvg
    llkpdltlflstqfgderyetvkfqekvkqtfmklldkeirkgdesitivdvtnkgiqev
    ealiwqivepvlsthidhdkfsff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2tmkB (B:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmkB (B:)
    grgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqlsd
    qaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdvg
    llkpdltlflstqfgderyetvkfqekvkqtfmklldkeirkgdesitivdvtnkgiqev
    ealiwqivepvlsthidhdkfsff