PDB entry 2tmg

View 2tmg on RCSB PDB site
Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e
Class: oxidoreductase
Keywords: metabolic role, glutamate, dehydrogenase, mutant, oxidoreductase
Deposited on 1998-12-04, released 1999-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.211
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (116)
      • engineered (127)
      • engineered (157)
      • engineered (159)
    Domains in SCOPe 2.07: d2tmga1, d2tmga2
  • Chain 'B':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (116)
      • engineered (127)
      • engineered (157)
      • engineered (159)
    Domains in SCOPe 2.07: d2tmgb1, d2tmgb2
  • Chain 'C':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (116)
      • engineered (127)
      • engineered (157)
      • engineered (159)
    Domains in SCOPe 2.07: d2tmgc1, d2tmgc2
  • Chain 'D':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (116)
      • engineered (127)
      • engineered (157)
      • engineered (159)
    Domains in SCOPe 2.07: d2tmgd1, d2tmgd2
  • Chain 'E':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (116)
      • engineered (127)
      • engineered (157)
      • engineered (159)
    Domains in SCOPe 2.07: d2tmge1, d2tmge2
  • Chain 'F':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (116)
      • engineered (127)
      • engineered (157)
      • engineered (159)
    Domains in SCOPe 2.07: d2tmgf1, d2tmgf2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2tmgA (A:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgA (A:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2tmgB (B:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgB (B:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2tmgC (C:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgC (C:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2tmgD (D:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgD (D:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2tmgE (E:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgE (E:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2tmgF (F:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgF (F:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr