PDB entry 2tld

View 2tld on RCSB PDB site
Description: crystal structure of an engineered subtilisin inhibitor complexed with bovine trypsin
Class: proteinase inhibitor (trypsin)
Keywords: proteinase inhibitor (trypsin)
Deposited on 1991-09-16, released 1992-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.173
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2tlde_
  • Chain 'I':
    Compound: streptomyces subtilisin inhibitor (ssi)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01006 (0-109)
      • conflict (66)
      • conflict (69)
    Domains in SCOPe 2.05: d2tldi_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tldE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagleggdscqgdsggpvv
    csgklqgivswgsgcaknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tldI (I:)
    salyapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnal
    trgedvgcpkvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf