PDB entry 2tir

View 2tir on RCSB PDB site
Description: crystal structure analysis of a mutant escherichia coli thioredoxin in which lysine 36 is replaced by glutamic acid
Class: electron transport
Keywords: electron transport
Deposited on 1993-01-10, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • conflict (35)
    Domains in SCOPe 2.08: d2tira_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tirA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpcemiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla