PDB entry 2tio

View 2tio on RCSB PDB site
Description: low packing density form of bovine beta-trypsin in cyclohexane
Deposited on 1998-09-23, released 1998-09-30
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2tioa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tioA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn