PDB entry 2tgi

View 2tgi on RCSB PDB site
Description: crystal structure of transforming growth factor-beta2: an unusual fold for the superfamily
Deposited on 1993-10-20, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2tgi__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tgi_ (-)
    aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
    vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs