PDB entry 2tgi

View 2tgi on RCSB PDB site
Description: crystal structure of transforming growth factor-beta2: an unusual fold for the superfamily
Class: growth factor
Keywords: growth factor
Deposited on 1993-10-20, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming growth factor ,beta 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2tgia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tgiA (A:)
    aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
    vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs